PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539718.1_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 174aa    MW: 20086.3 Da    PI: 9.9323
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539718.1_FGP003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.1e-5431301128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+
  KN539718.1_FGP003   3 LPPGFRFHPTDDELVGYYLKRKVDSLKIEL-EVIPVIDLYKFEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATSTGYWKATGKDR 93 
                        79****************************.99**************95334445667********************************** PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ +  ge+ gl+ktLvfykgrap ge+tdWvmheyrl
  KN539718.1_FGP003  94 KIAC-AGEVFGLRKTLVFYKGRAPGGERTDWVMHEYRL 130
                        ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-612152IPR003441NAC domain
PROSITE profilePS5100557.8383153IPR003441NAC domain
PfamPF023658.3E-304130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDSLKI ELEVIPVIDL YKFEPWELPE KSFLPKRDLE  60
WFFFCPRDRK YPNGSRTNRA TSTGYWKATG KDRKIACAGE VFGLRKTLVF YKGRAPGGER  120
TDWVMHEYRL CQDLAHGVSN FIGAYALCRV IKRHEAGLHG EPPAAKAKGM MSKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-55115715169NO APICAL MERISTEM PROTEIN
1ut4_B4e-55115715169NO APICAL MERISTEM PROTEIN
1ut7_A4e-55115715169NO APICAL MERISTEM PROTEIN
1ut7_B4e-55115715169NO APICAL MERISTEM PROTEIN
4dul_A4e-55115715169NAC domain-containing protein 19
4dul_B4e-55115715169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332460.0CT833246.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI238F12, full insert sequence.
GenBankCT8332470.0CT833247.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI241J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612876.11e-126PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotA4VCM07e-70NAC45_ARATH; NAC domain-containing protein 45
SwissprotQ9FFI57e-70NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0D3HGU31e-126A0A0D3HGU3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0R2S11e-126A0A0E0R2S1_ORYRU; Uncharacterized protein
TrEMBLI1QW581e-126I1QW58_ORYGL; Uncharacterized protein
TrEMBLQ7G1M81e-126Q7G1M8_ORYSJ; No apical meristem, putative, expressed
STRINGLOC_Os10g42130.11e-125(Oryza sativa Japonica Group)
STRINGORGLA10G0144100.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-84NAC domain containing protein 71